Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human CTD nuclear envelope phosphatase 1(CTDNEP1)

Recombinant Human CTD nuclear envelope phosphatase 1(CTDNEP1)

SKU:CSB-CF007227HU

Regular price ¥280,200 JPY
Regular price Sale price ¥280,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O95476

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

Protein Names:Recommended name: CTD nuclear envelope phosphatase 1 EC= 3.1.3.16 Alternative name(s): Serine/threonine-protein phosphatase dullard

Gene Names:Name:CTDNEP1 Synonyms:DULLARD

Expression Region:1-244

Sequence Info:full length protein

View full details