Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Corticotropin-releasing factor receptor 1(CRHR1),partial

Recombinant Human Corticotropin-releasing factor receptor 1(CRHR1),partial

SKU:CSB-YP005965HU-GB

Regular price ¥141,500 JPY
Regular price Sale price ¥141,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Neuroscience

Uniprot ID: P34998

Gene Names: CRHR1

Organism: Homo sapiens (Human)

AA Sequence: ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Expression Region: 23-121aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 13 kDa

Alternative Name(s): Corticotropin-releasing hormone receptor 1 ;CRH-R-1 ;CRH-R1

Relevance: G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal bryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.

Reference: Expression cloning of a human corticotropin-releasing-factor receptor.Chen R., Lewis K.A., Perrin M.H., Vale W.W.Proc. Natl. Acad. Sci. U.S.A. 90:8967-8971(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details