
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Cancer
Uniprot ID: P80365
Gene Names: HSD11B2
Organism: Homo sapiens (Human)
AA Sequence: MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Expression Region: 1-405aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 46.1 kDa
Alternative Name(s): 11-beta-hydroxysteroid dehydrogenase type 2 ;11-DH2 ;11-beta-HSD211-beta-hydroxysteroid dehydrogenase type II ;-HSD11 type IINAD-dependent 11-beta-hydroxysteroid dehydrogenase ;11-beta-HSDShort chain dehydrogenase/reductase family 9C member 3
Relevance: Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Reference: Cloning and tissue distribution of the human 11 beta-hydroxysteroid dehydrogenase type 2 enzyme.Albiston A.L., Obeyesekere V.R., Smith R.E., Krozowski Z.S.Mol. Cell. Endocrinol. 105:R11-R17(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 1(HSD11B1)
- Regular price
- ¥105,300 JPY
- Sale price
- ¥105,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
HSD11B2 Antibody, Biotin conjugated - Cat. #: CSB-PA010765LD01HU
- Regular price
- ¥55,400 JPY
- Sale price
- ¥55,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
HSD11B2 Antibody, FITC conjugated - Cat. #: CSB-PA010765LC01HU
- Regular price
- ¥55,400 JPY
- Sale price
- ¥55,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
HSD11B2 Antibody, HRP conjugated - Cat. #: CSB-PA010765LB01HU
- Regular price
- ¥55,400 JPY
- Sale price
- ¥55,400 JPY
- Regular price
-
- Unit price
- per
Sold out