Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cortexin-3(CTXN3)

Recombinant Human Cortexin-3(CTXN3)

SKU:CSB-CF686853HU

Regular price ¥219,600 JPY
Regular price Sale price ¥219,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q4LDR2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMP TSTWADGLEGLEKGQFDHALA

Protein Names:Recommended name: Cortexin-3 Alternative name(s): Kidney and brain-expressed protein

Gene Names:Name:CTXN3 Synonyms:KABE

Expression Region:1-81

Sequence Info:full length protein

View full details