Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human coronavirus 229E Non-structural protein 4a (4a)

Recombinant Human coronavirus 229E Non-structural protein 4a (4a)

SKU:CSB-CF325698HIT

Regular price ¥225,200 JPY
Regular price Sale price ¥225,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human coronavirus 229E (HCoV-229E)

Uniprot NO.:P19739

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KVSAEVSRQVIQDVKDGTVTFNLLAYTLMSLFVVYFALFKARSHRGRAALIVFKILILFV YVPLLYWSQAYIYATLIAVILLGRFFHTAWHCWLYKTWDFIVFNVTTLCYAR

Protein Names:Recommended name: Non-structural protein 4a Short name= ns4a Alternative name(s): Accessory protein 4a

Gene Names:ORF Names:4a

Expression Region:22-133

Sequence Info:full length protein

View full details