
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: Q9H0A8
Gene Names: COMMD4
Organism: Homo sapiens (Human)
AA Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM
Expression Region: 1-195aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 48.4 kDa
Alternative Name(s):
Relevance: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes . Down-regulates activation of NF-kappa-B.
Reference: COMMD proteins, a novel family of structural and functional homologs of MURR1.Burstein E., Hoberg J.E., Wilkinson A.S., Rumble J.M., Csomos R.A., Komarck C.M., Maine G.N., Wilkinson J.C., Mayo M.W., Duckett C.S.J. Biol. Chem. 280:22222-22232(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human HAUS augmin-like complex subunit 4(HAUS4)
- Regular price
- ¥119,400 JPY
- Sale price
- ¥119,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Stathmin-4(STMN4)
- Regular price
- ¥105,500 JPY
- Sale price
- ¥105,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Uncharacterized protein C4orf29(C4orf29)
- Regular price
- ¥134,900 JPY
- Sale price
- ¥134,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CD40 ligand(CD40LG),partial
- Regular price
- ¥105,500 JPY
- Sale price
- ¥105,500 JPY
- Regular price
-
- Unit price
- per
Sold out