Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Claudin-5(CLDN5)

Recombinant Human Claudin-5(CLDN5)

SKU:CSB-CF005507HU

Regular price ¥279,200 JPY
Regular price Sale price ¥279,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O00501

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV

Protein Names:Recommended name: Claudin-5Alternative name(s): Transmembrane protein deleted in VCFS Short name= TMDVCF

Gene Names:Name:CLDN5Synonyms:AWAL, TMVCF

Expression Region:1-218

Sequence Info:full length protein

View full details