
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:P56856
Gene Names:CLDN18
Organism:Homo sapiens (Human)
AA Sequence:DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR
Expression Region:28-80aa
Sequence Info:Partial of Isoform A2
Source:E.coli
Tag Info:N-terminal GST-tagged
MW:32.8 kDa
Alternative Name(s):Claudin-18
Relevance:Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Reference:"Claudin-18 is an early-stage marker of pancreatic carcinogenesis." Tanaka M., Shibahara J., Fukushima N., Shinozaki A., Umeda M., Ishikawa S., Kokudo N., Fukayama M. J Histochem Cytochem 59:942-952(2011)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:13-23 business days
You may also like
-
Recombinant Human Syndecan-1(SDC1)
- Regular price
- ¥177,300 JPY
- Sale price
- ¥177,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Azurocidin(AZU1)
- Regular price
- ¥220,800 JPY
- Sale price
- ¥220,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Coiled-coil domain-containing protein 112(CCDC112),partial
- Regular price
- ¥97,900 JPY
- Sale price
- ¥97,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Myocardin-related transcription factor A(MRTFA),partial
- Regular price
- ¥97,900 JPY
- Sale price
- ¥97,900 JPY
- Regular price
-
- Unit price
- per
Sold out