Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 1(CMTM1)

Recombinant Human CKLF-like MARVEL transmembrane domain-containing protein 1(CMTM1)

SKU:CSB-CF814239HU

Regular price ¥264,000 JPY
Regular price Sale price ¥264,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8IZ96

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFF ILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGSLCLTAV IVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA

Protein Names:Recommended name: CKLF-like MARVEL transmembrane domain-containing protein 1 Alternative name(s): Chemokine-like factor superfamily member 1

Gene Names:Name:CMTM1 Synonyms:CKLFSF1

Expression Region:1-169

Sequence Info:full length protein

View full details