Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cementoblastoma-derived protein 1(CEMP1)

Recombinant Human Cementoblastoma-derived protein 1(CEMP1)

SKU:CSB-YP764814HU

Regular price ¥141,500 JPY
Regular price Sale price ¥141,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cell Biology

Uniprot ID: Q6PRD7

Gene Names: CEMP1

Organism: Homo sapiens (Human)

AA Sequence: MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG

Expression Region: 1-247aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 28 kDa

Alternative Name(s): Cementum protein 1Cementum protein 23 ;CP-23

Relevance:

Reference: Molecular cloning, expression and immunolocalization of a novel human cementum-derived protein (CP-23).Alvarez-Perez M.A., Narayanan S., Zeichner-David M., Rodriguez Carmona B., Arzate H.Bone 38:409-419(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details