Recombinant Human CD99 antigen(CD99)

SKU: CSB-CF004973HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P14209

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK

Protein Names:Recommended name: CD99 antigen Alternative name(s): 12E7 E2 antigen Protein MIC2 T-cell surface glycoprotein E2 CD_antigen= CD99

Gene Names:Name:CD99 Synonyms:MIC2, MIC2X, MIC2Y

Expression Region:23-185

Sequence Info:full length protein