
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cardiovascular
Uniprot ID: P13987
Gene Names: CD59
Organism: Homo sapiens (Human)
AA Sequence: LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Expression Region: 26-102aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 36 kDa
Alternative Name(s): 1F5 antigen20KDA homologous restriction factor ;HRF-20 ;HRF20MAC-inhibitory protein ;MAC-IPMEM43 antigen;Membrane attack complex inhibition factor ;MACIF;Membrane inhibitor of reactive lysis ;MIRLProtectin; CD59
Relevance: Potent inhibitor of the complent mbrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complents of the assbling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.The soluble form from urine retains its specific complent binding activity, but exhibits greatly reduced ability to inhibit MAC assbly on cell mbranes.
Reference: CD59, an LY-6-like protein expressed in human lymphoid cells, regulates the action of the complement membrane attack complex on homologous cells.Davies A., Simmons D.L., Hale G., Harrison R.A., Tighe H., Lachmann P.J., Waldmann H.J. Exp. Med. 170:637-654(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human CD59 glycoprotein(CD59)
- Regular price
- ¥118,300 JPY
- Sale price
- ¥118,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CD59 glycoprotein(CD59)
- Regular price
- ¥118,300 JPY
- Sale price
- ¥118,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Macrophage-capping protein(CAPG)
- Regular price
- ¥105,900 JPY
- Sale price
- ¥105,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Complement C5(C5) ,partial
- Regular price
- ¥105,900 JPY
- Sale price
- ¥105,900 JPY
- Regular price
-
- Unit price
- per
Sold out