Recombinant Human CCAAT-enhancer-binding protein gamma(CEBPG),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human CCAAT-enhancer-binding protein gamma(CEBPG),partial

CSB-RP135574h
Regular price
¥81,500 JPY
Sale price
¥81,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transcription

Uniprot ID: P53567

Gene Names: CEBPG

Organism: Homo sapiens (Human)

AA Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNA

Expression Region: 1-148aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 20.2 kDa

Alternative Name(s):

Relevance: Transcription factor that binds to the enhancer elent PRE-I (positive regulatory elent-I) of the IL-4 gene. Might change the DNA-binding specificity of other transcription factors and recruit th to unusual DNA sites.

Reference: Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter.Davydov I.V., Bohmann D., Krammer P.H., Li-Weber M.Gene 161:271-275(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human CCAAT-enhancer-binding protein gamma(CEBPG)
    Regular price
    ¥81,500 JPY
    Sale price
    ¥81,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Interleukin-4(IL-4)
    Regular price
    ¥81,500 JPY
    Sale price
    ¥81,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Proteasome activator complex subunit 1(PSME1)
    Regular price
    ¥81,500 JPY
    Sale price
    ¥81,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Early growth response protein 1(EGR1),partial
    Regular price
    ¥91,100 JPY
    Sale price
    ¥91,100 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share