Gene Bio Systems
Recombinant Human Cathelicidin antimicrobial peptide(CAMP)
Recombinant Human Cathelicidin antimicrobial peptide(CAMP)
SKU:CSB-EP004476HUb3
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P49913
Gene Names: CAMP
Organism: Homo sapiens (Human)
AA Sequence: FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Expression Region: 132-170aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 24.7 kDa
Alternative Name(s): 18KDA cationic antimicrobial protein
Relevance: Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
Reference: "FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis." Agerberth B., Gunne H., Odeberg J., Kogner P., Boman H.G., Gudmundsson G.H. Proc. Natl. Acad. Sci. U.S.A. 92:195-199(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
