Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Casein kinase I isoform alpha-like(CSNK1A1L)

Recombinant Human Casein kinase I isoform alpha-like(CSNK1A1L)

SKU:CSB-EP839816HU

Regular price ¥162,100 JPY
Regular price Sale price ¥162,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8N752

Gene Names: CSNK1A1L

Organism: Homo sapiens (Human)

AA Sequence: MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN

Expression Region: 1-337aa

Sequence Info: Full Length of BC028723

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 66.1 kDa

Alternative Name(s): CK1

Relevance: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis.

Reference: "Functional specialization of beta-arrestin interactions revealed by proteomic analysis." Xiao K., McClatchy D.B., Shukla A.K., Zhao Y., Chen M., Shenoy S.K., Yates J.R., Lefkowitz R.J. Proc. Natl. Acad. Sci. U.S.A. 104:12011-12016(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details