Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) (Active)

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) (Active)

SKU:P31997

Regular price ¥61,700 JPY
Regular price Sale price ¥61,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: P31997

Gene Names: CEACAM8

Alternative Name(s): CGM6

Abbreviation: Recombinant Human CEACAM8 protein (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 35-320aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD

MW: 34.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 at 2 μg/mL can bind Anti-CEACAM8 recombinant antibody (CSB-RA005168MA1HU). The EC50 is 19.38-21.68 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Cell surface glycoprotein that plays a role in cell adhesion in a calcium-independent manner; Mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6; Heterophilic interaction with CEACAM8 occurs in activated neutrophils.

Reference: "Cloning of a carcinoembryonic antigen gene family member expressed in leukocytes of chronic myeloid leukemia patients and bone marrow." Berling B., Kolbinger F., Grunert F., Thompson J.A., Brombacher F., Buchegger F., Vkleist S., Zimmermann W. Cancer Res. 50: 6534-6539 (1990) "Characterization of a cDNA clone encoding a new species of the nonspecific cross-reacting antigen (NCA), a member of the CEA gene family." Arakawa F., Kuroki M., Misumi Y., Oikawa S., Nakazato H., Matsuoka Y. Biochem. Biophys. Res. Commun. 166: 1063-1071 (1990) "Identification of three new genes and estimation of the size of the carcinoembryonic antigen family." Khan W.N., Fraengsmyr L., Teglund S., Israelsson A., Bremer K., Hammarstroem S. Genomics 14: 384-390 (1992)

Function:

View full details