
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P42830
Gene Names: CXCL5
Organism: Homo sapiens (Human)
AA Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG
Expression Region: 37-110aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.9 kDa
Alternative Name(s): ENA-78(1-78)Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5
Relevance: Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chotactic activity for neutrophil granulocytes.
Reference: Regulation of the immune response by the interaction of chemokines and proteases.Struyf S., Proost P., Van Damme J.Adv. Immunol. 81:1-44(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human C-X-C motif chemokine 5(CXCL5),partial
- Regular price
- ¥105,100 JPY
- Sale price
- ¥105,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human C-X-C motif chemokine 5 protein(CXCL5) (Active)
- Regular price
- ¥173,500 JPY
- Sale price
- ¥173,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human C-X-C motif chemokine 5(CXCL5),partial(Active)
- Regular price
- ¥173,500 JPY
- Sale price
- ¥173,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CXCL5
- Regular price
- ¥84,200 JPY
- Sale price
- ¥84,200 JPY
- Regular price
-
- Unit price
- per
Sold out