Skip to product information
1 of 1

GeneBio Systems

Recombinant Human C-X-C chemokine receptor type 5(CXCR5), partial

Recombinant Human C-X-C chemokine receptor type 5(CXCR5), partial

SKU:P32302

Regular price ¥104,700 JPY
Regular price Sale price ¥104,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: P32302

Gene Names: CXCR5

Alternative Name(s): CXC-R5;CXCR-5;Burkitt lymphoma receptor 1;Monocyte-derived receptor 15;MDR-15;CD antigen CD185

Abbreviation: Recombinant Human CXCR5 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-55aa

Protein Length: partial

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP

MW: 19.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Cytokine receptor that binds to B-lymphocyte chemoattractant (BLC). Involved in B-cell migration into B-cell follicles of spleen and Peyer patches but not into those of mesenteric or peripheral lymph nodes. May have a regulatory function in Burkitt lymphoma (BL) lymphomagenesis and/or B-cell differentiation.

Reference:

Function:

View full details