
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P13501
Gene Names: CCL5
Organism: Homo sapiens (Human)
AA Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Expression Region: 24-91aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.9 kDa
Alternative Name(s): EoCPEosinophil chemotactic cytokine;SIS-delta;Small-inducible cytokine A5T cell-specific protein P228 ;TCP228T-cell-specific protein RANTES
Relevance: Choattractant for blood monocytes, mory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils . May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells
Reference: Multiple pathways of amino terminal processing produce two truncated variants of RANTES/CCL5.Lim J.K., Burns J.M., Lu W., DeVico A.L.J. Leukoc. Biol. 78:442-452(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human C-C motif chemokine 5(CCL5)
- Regular price
- ¥81,600 JPY
- Sale price
- ¥81,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
CCL5 Antibody, Biotin conjugated - Cat. #: CSB-PA05955D0Rb
- Regular price
- ¥49,700 JPY
- Sale price
- ¥49,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
CCL5 Antibody, HRP conjugated - Cat. #: CSB-PA05955B0Rb
- Regular price
- ¥49,700 JPY
- Sale price
- ¥49,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
CCL5 Antibody, HRP conjugated - Cat. #: CSB-PA05959B0Rb
- Regular price
- ¥49,700 JPY
- Sale price
- ¥49,700 JPY
- Regular price
-
- Unit price
- per
Sold out