Skip to product information
1 of 1

GeneBio Systems

Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)

Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)

SKU:P51686

Regular price ¥234,400 JPY
Regular price Sale price ¥234,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: P51686

Gene Names: CCR9

Alternative Name(s): C-C CKR-9; CC-CKR-9; CCR-9;G-protein coupled receptor 28;GPR-9-6

Abbreviation: Recombinant Human CCR9 protein-VLPs (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 1-369aa

Protein Length: Full Length

Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Target Protein Sequence: MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL

MW: 43.4 kDa

Purity: Greater than 95% as determined by SEC-HPLC.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10 μg/mL can bind Anti-CCR9 recombinant antibody (CSB-RA004848MA1HU). The EC50 is 31.67-36.83 ng/mL.The VLPs (CSB-MP3838) is negative control.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Relevance: Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.

Reference:

Function:

View full details