Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Basic leucine zipper and W2 domain-containing protein 2(BZW2) (Active)

Recombinant Human Basic leucine zipper and W2 domain-containing protein 2(BZW2) (Active)

SKU:CSB-EP896544HU

Regular price ¥291,800 JPY
Regular price Sale price ¥291,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:1mg. Other sizes are also available. Please contact us.

Research Areas:Cell Biology

Uniprot NO.:Q9Y6E2

Uniprot Entry Name:

Gene Names:BZW2

Species:Homo sapiens (Human)

Source:E.coli

Expression Region:1-419aa

Sequence:MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

Protein Description:Full Length

Tag Info:N-terminal GST-tagged

Mol. Weight:75.2 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 ?g/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 ?g/ml.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Not test.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:

Relevance:May be involved in neuronal differentiation.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

View full details