Gene Bio Systems
Recombinant Human ATP-sensitive inward rectifier potassium channel 1(KCNJ1),partial
Recombinant Human ATP-sensitive inward rectifier potassium channel 1(KCNJ1),partial
SKU:CSB-YP012047HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Signal Transduction
Uniprot ID: P48048
Gene Names: KCNJ1
Organism: Homo sapiens (Human)
AA Sequence: ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM
Expression Region: 178-391
Sequence Info: Cytoplasmic Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 26.3 kDa
Alternative Name(s): ATP-regulated potassium channel ROM-KInward rectifier K(+) channel Kir1.1;Potassium channel, inwardly rectifying subfamily J member 1
Relevance: In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of Extracellular domain potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.
Reference: Cloning and characterization of multiple forms of the human kidney ROM-K potassium channel.Shuck M.E., Bock J.H., Benjamin C.W., Tsai T.-D., Lee K.S., Slightom J.L., Bienkowski M.J.J. Biol. Chem. 269:24261-24270(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
