
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Metabolism
Uniprot ID: P53396
Gene Names: ACLY
Organism: Homo sapiens (Human)
AA Sequence: KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK
Expression Region: 4-265aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 45.5 kDa
Alternative Name(s): ATP-citrate (pro-S-)-lyase Short name:ACL Citrate cleavage enzyme
Relevance: ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine.
Reference: "Cloning and expression of a human ATP-citrate lyase cDNA."Elshourbagy N.A., Near J.C., Kmetz P.J., Wells T.N.C., Groot P.H.E., Saxty B.A., Hughes S.A., Franklin M., Gloger I.S.Eur. J. Biochem. 204:491-499(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human ATP-citRate synthase(ACLY),partial
- Regular price
- ¥105,900 JPY
- Sale price
- ¥105,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human 3-ketoacyl-CoA thiolase, mitochondrial(ACAA2),partial
- Regular price
- ¥120,200 JPY
- Sale price
- ¥120,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Aspartoacylase(ASPA)
- Regular price
- ¥85,400 JPY
- Sale price
- ¥85,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Aspartoacylase(ASPA)
- Regular price
- ¥73,000 JPY
- Sale price
- ¥73,000 JPY
- Regular price
-
- Unit price
- per
Sold out