Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Apolipoprotein O(APOO)

Recombinant Human Apolipoprotein O(APOO)

SKU:CSB-CF001948HU

Regular price ¥270,900 JPY
Regular price Sale price ¥270,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BUR5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQT KPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGL AASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Protein Names:Recommended name: Apolipoprotein O Alternative name(s): Protein FAM121B

Gene Names:Name:APOO Synonyms:FAM121B ORF Names:My025, UNQ1866/PRO4302

Expression Region:26-198

Sequence Info:full length protein

View full details