Skip to product information
1 of 1

GeneBio Systems

Recombinant Human AP-3 complex subunit beta-2 (AP3B2), partial

Recombinant Human AP-3 complex subunit beta-2 (AP3B2), partial

SKU:Q13367

Regular price ¥121,400 JPY
Regular price Sale price ¥121,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Neuroscience

Uniprot ID: Q13367

Gene Names: AP3B2

Alternative Name(s): (Adaptor protein complex AP-3 subunit beta-2)(Adaptor-related protein complex 3 subunit beta-2)(Beta-3B-adaptin)(Clathrin assembly protein complex 3 beta-2 large chain)(Neuron-specific vesicle coat protein beta-NAP)

Abbreviation: Recombinant Human AP3B2 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 973-1078aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: APVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATANLGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQ

MW: 19.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 (AP-3) that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.

Reference: "Autoimmune gait disturbance accompanying adaptor protein-3B2-IgG." Honorat J.A., Lopez-Chiriboga A.S., Kryzer T.J., Komorowski L., Scharf M., Hinson S.R., Lennon V.A., Pittock S.J., Klein C.J., McKeon A. Neurology 93: e954-e963(2019)

Function:

View full details