Skip to product information
1 of 1

GeneBio Systems

Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial, Biotinylated

Recombinant Human adenovirus F serotype 41 Hexon protein (L3), partial, Biotinylated

SKU:P11820

Regular price ¥183,600 JPY
Regular price Sale price ¥183,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Signal Transduction

Uniprot ID: P11820

Gene Names: L3

Alternative Name(s): (CP-H)(Protein II)

Abbreviation: Recombinant Human adenovirus F serotype 41 Hexon protein, partial, Biotinylated

Organism: Human adenovirus F serotype 41 (HAdV-41) (Human adenovirus 41)

Source: E.coli

Expression Region: 609-925aa

Protein Length: Partial

Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Target Protein Sequence: NDTNDQSFNDYLCAANMLYPIPSNATSVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFTYSGSVPYLDGTFYLNHTFKKVSIMFDSSVSWPGNDRLLTPNEFEIKRTVDGEGYNVAQCNMTKDWFLIQMLSHYNIGYQGFYVPESYKDRMYSFFRNFQPMSRQVVNTTTYKEYQNVTLPFQHNNSGFVGYMGPTMREGQAYPANYPYPLIGQTAVPSLTQKKFLCDRTMWRIPFSSNFMSMGALTDLGQNMLYANSAHALDMTFEVDPMDEPTLLYVLFEVFDVVRIHQPHRGVIEAVYLRTPFSAGNATT

MW: 84.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Structural component of the T=16 icosahedral capsid. The capsid is composed of pentamers and hexamers of major capsid protein/MCP, which are linked together by heterotrimers called triplexes. These triplexes are formed by a single molecule of triplex protein 1/TRX1 and two copies of triplex protein 2/TRX2. Additionally, TRX1 is required for efficient transport of TRX2 to the nucleus, which is the site of capsid assembly.

Reference: "Structures of capsid and capsid-associated tegument complex inside the Epstein-Barr virus." Liu W., Cui Y., Wang C., Li Z., Gong D., Dai X., Bi G.Q., Sun R., Zhou Z.H. Nat Microbiol 5: 1285-1298(2020)

Function:

View full details