Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Actin, alpha cardiac muscle 1 (ACTC1), partial

Recombinant Human Actin, alpha cardiac muscle 1 (ACTC1), partial

SKU:P68032

Regular price ¥310,400 JPY
Regular price Sale price ¥310,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cardiovascular

Uniprot ID: P68032

Gene Names: ACTC1

Alternative Name(s): (Alpha-cardiac actin)

Abbreviation: Recombinant Human ACTC1 protein, partial

Organism: Homo sapiens (Human)

Source: Baculovirus

Expression Region: 3-377aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

MW: 47.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

Reference: "ACD toxin-produced actin oligomers poison formin-controlled actin polymerization." Heisler D.B., Kudryashova E., Grinevich D.O., Suarez C., Winkelman J.D., Birukov K.G., Kotha S.R., Parinandi N.L., Vavylonis D., Kovar D.R., Kudryashov D.S. Science 349: 535-539(2015)

Function:

View full details