Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human 60S ribosomal protein L36a-like(RPL36AL)

Recombinant Human 60S ribosomal protein L36a-like(RPL36AL)

SKU:CSB-RP018044h

Regular price ¥124,700 JPY
Regular price Sale price ¥124,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: Q969Q0

Gene Names: RPL36AL

Organism: Homo sapiens (Human)

AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF

Expression Region: 1-106aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.5 kDa

Alternative Name(s):

Relevance:

Reference: Characterisation of an mRNA encoding a human ribosomal protein homologous to the yeast L44 ribosomal protein.Davies M.S., Henney A., Ward W.H.J., Craig R.K.Gene 45:183-191(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details