Gene Bio Systems
Recombinant Human 60S ribosomal protein L10a(RPL10A),partial
Recombinant Human 60S ribosomal protein L10a(RPL10A),partial
SKU:CSB-RP052444h
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: P62906
Gene Names: RPL10A
Organism: Homo sapiens (Human)
AA Sequence: KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQR
Expression Region: 4-215aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 51.2 kDa
Alternative Name(s): CSA-19Neural precursor cell expressed developmentally down-regulated protein 6 ;NEDD-6
Relevance:
Reference: Identification of genes downregulated in the thymus by cyclosporin-A preliminary characterization of clone CSA-19.Fisicaro N., Katerelos M., Williams J., Power D., D'Apice A., Pearse M.Mol. Immunol. 32:565-572(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
