Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human 40S ribosomal protein S27(RPS27)

Recombinant Human 40S ribosomal protein S27(RPS27)

SKU:CSB-EP020419HU

Regular price ¥157,700 JPY
Regular price Sale price ¥157,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P42677

Gene Names: RPS27

Organism: Homo sapiens (Human)

AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH

Expression Region: 1-84aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 36.3 kDa

Alternative Name(s): Metallopan-stimulin 1

Relevance:

Reference: "A growth factor-inducible gene encodes a novel nuclear protein with zinc finger structure." Fernandez-Pol J.A., Klos D.J., Hamilton P.D. J. Biol. Chem. 268:21198-21204(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details