Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human 39S ribosomal protein L12, mitochondrial(MRPL12)

Recombinant Human 39S ribosomal protein L12, mitochondrial(MRPL12)

SKU:CSB-EP014817HU

Regular price ¥157,400 JPY
Regular price Sale price ¥157,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Tags & Cell Markers

Uniprot ID: P52815

Gene Names: MRPL12

Organism: Homo sapiens (Human)

AA Sequence: EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE

Expression Region: 1-198aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 43.4 kDa

Alternative Name(s): 5c5-2

Relevance:

Reference: "A delayed-early response nuclear gene encoding MRPL12, the mitochondrial homologue to the bacterial translational regulator L7/L12 protein." Marty L., Fort P. J. Biol. Chem. 271:11468-11476(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details