Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human 3-hydroxyacyl-CoA dehydratase 4(PTPLAD2)

Recombinant Human 3-hydroxyacyl-CoA dehydratase 4(PTPLAD2)

SKU:CSB-CF716579HU

Regular price ¥273,700 JPY
Regular price Sale price ¥273,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q5VWC8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLV MRLCQSVSLLELLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVF WNLLDMVRYTYSMLSVIGISYAVLTWLSQTLWMPIYPLCVLAEAFAIYQSLPYFESFGTY STKLPFDLSIYFPYVLKIYLMMLFIGMYFTYSHLYSERRDILGIFPIKKKKM

Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase 4 Short name= HACD4 EC= 4.2.1.- Alternative name(s): Protein tyrosine phosphatase-like protein PTPLAD2 Protein-tyrosine phosphatase-like A domain-containing protein 2

Gene Names:Name:PTPLAD2 Synonyms:HACD4

Expression Region:1-232

Sequence Info:full length protein

View full details