Skip to product information
1 of 1

Gene Bio Systems

Recombinant Horse Interleukin-7 receptor subunit alpha(IL7R)

Recombinant Horse Interleukin-7 receptor subunit alpha(IL7R)

SKU:CSB-CF011670HO

Regular price ¥316,200 JPY
Regular price Sale price ¥316,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Equus caballus (Horse)

Uniprot NO.:A0MSX9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ESGYAQNGDFEDAELDDYSFSCYSQLEVDGPQHLLSCAFEDPDVNSTNLEFEICEGLLEVKCLNFSKLQETYFIKTKKFLLIGDSTICVKLGGKHITCQKLNIVKRVKPEAPFDVKVIYREEANEFVVTFNTSHLQKKYVKDLLHEVVYRLEKNENDWMHVNISSTKLTLLQRKLQPNAMYEIKVRSIPNTNYFEGFWSEWSPSSHFRTPENNSGKMDPVLLIISIVSFFSVALMVILACVLWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPESFLDCQIHKVDGIQARDEAEAFLQDTFPPQLDDSEKQRLGGGVQGLNWPSQHAVITPKTFGGESPLRCLSGSVTVCDVPVIPSSRPPDCREGGKNGPHVYQGLLLGAGTTNSTLPHLFPFQSGILTLNPAVQGQPLFTSLGSSQEEAYVTMSSFYQNQ

Protein Names:Recommended name: Interleukin-7 receptor subunit alpha Short name= IL-7 receptor subunit alpha Short name= IL-7R subunit alpha Short name= IL-7R-alpha Short name= IL-7RA Alternative name(s): CD_antigen= CD127

Gene Names:Name:IL7R

Expression Region:21-458

Sequence Info:full length protein

View full details