Skip to product information
1 of 1

Gene Bio Systems

Recombinant Horse Glycophorin-A

Recombinant Horse Glycophorin-A

SKU:CSB-CF010074HO

Regular price ¥255,100 JPY
Regular price Sale price ¥255,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equus caballus (Horse)

Uniprot NO.:P02726

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QTIATGSPPIAGTSDLSTITSAATPTFTTEQDGREQGDGLQLAHDFSQPVITVIILGVMA GIIGIILLLAYVSRRLRKRPPADVPPPASTVPSADAPPPVSEDDETSLTSVETDYPGDSQ

Protein Names:Recommended name: Glycophorin-A Alternative name(s): Glycophorin-HA CD_antigen= CD235a

Gene Names:

Expression Region:1-120

Sequence Info:full length protein

View full details