Gene Bio Systems
Recombinant Horse Glycophorin-A
Recombinant Horse Glycophorin-A
SKU:CSB-CF010074HO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Equus caballus (Horse)
Uniprot NO.:P02726
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QTIATGSPPIAGTSDLSTITSAATPTFTTEQDGREQGDGLQLAHDFSQPVITVIILGVMA GIIGIILLLAYVSRRLRKRPPADVPPPASTVPSADAPPPVSEDDETSLTSVETDYPGDSQ
Protein Names:Recommended name: Glycophorin-A Alternative name(s): Glycophorin-HA CD_antigen= CD235a
Gene Names:
Expression Region:1-120
Sequence Info:full length protein
