Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hordeum vulgare Photosystem I reaction center subunit XI, chloroplastic(PSAL)

Recombinant Hordeum vulgare Photosystem I reaction center subunit XI, chloroplastic(PSAL)

SKU:CSB-CF329436HWQ

Regular price ¥271,600 JPY
Regular price Sale price ¥271,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hordeum vulgare (Barley)

Uniprot NO.:P23993

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AVKSDKPTYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLA HGYLLVGPFALTGPLRNTPVHGQAGTLGAIGLVSILSVCLTMYGVASFNEGEPSTAPVLT LTGRKKEADKLQTAEGWSQFTGGFFFGGVSGAVWAYFLLYVLDLPYFFK

Protein Names:Recommended name: Photosystem I reaction center subunit XI, chloroplastic Short name= PSI-L Alternative name(s): PSI subunit V

Gene Names:Name:PSAL

Expression Region:41-209

Sequence Info:full length protein

View full details