Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hordeum vulgare Defender against cell death 2(DAD2)

Recombinant Hordeum vulgare Defender against cell death 2(DAD2)

SKU:CSB-CF882906HWQ

Regular price ¥253,900 JPY
Regular price Sale price ¥253,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hordeum vulgare (Barley)

Uniprot NO.:Q9SME8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKAAGDAKLLIQSLNKAYAATPTNLKIIDLYVVFAVATALVQVVYMGIVGSFPFNSFLS GVLSSIGTAVLGVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG

Protein Names:Recommended name: Defender against cell death 2 Short name= DAD-2

Gene Names:Name:DAD2

Expression Region:1-114

Sequence Info:full length protein

View full details