Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-21, chloroplastic(LHC Ib-21)

Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-21, chloroplastic(LHC Ib-21)

SKU:CSB-CF874392HWQ

Regular price ¥277,700 JPY
Regular price Sale price ¥277,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Hordeum vulgare (Barley)

Uniprot NO.:Q9SDM1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SAEWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVP EALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEK KKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATH LADPWHNNIGDIVIPRNIYGP

Protein Names:Recommended name: Chlorophyll a-b binding protein 1B-21, chloroplastic Alternative name(s): LHCI type I CAB-1B-21 LHCI-730 chlorophyll a/b binding protein Light-harvesting complex I 21 kDa protein

Gene Names:Name:LHC Ib-21 Synonyms:LHCA1

Expression Region:45-245

Sequence Info:full length protein

View full details