Gene Bio Systems
Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-20, chloroplastic(LHC Ib-20)
Recombinant Hordeum vulgare Chlorophyll a-b binding protein 1B-20, chloroplastic(LHC Ib-20)
SKU:CSB-CF657782HWQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Hordeum vulgare (Barley)
Uniprot NO.:Q36718
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AKGSWLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLI PEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSSTYVEIRRWQDIKNPGSVNQDPI FKSYSLPPHECGYPGRVFNPLNFAPLENKEKELANGRLAMLAFLGFLVQHNVHGKGPFEN LQQHLADPWHNTIIQTISGQ
Protein Names:Recommended name: Chlorophyll a-b binding protein 1B-20, chloroplastic Alternative name(s): LHCI type I CAB-1B-20 Light-harvesting complex I 20 kDa protein
Gene Names:Name:LHC Ib-20
Expression Region:32-231
Sequence Info:full length protein
