Skip to product information
1 of 1

Gene Bio Systems

Recombinant Heterosigma akashiwo ATP synthase subunit c, chloroplastic(atpH)

Recombinant Heterosigma akashiwo ATP synthase subunit c, chloroplastic(atpH)

SKU:CSB-CF455134HWG

Regular price ¥248,100 JPY
Regular price Sale price ¥248,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Heterosigma akashiwo (strain CCMP452)

Uniprot NO.:B2XTP2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSIISAASVIAAGLSVGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFM EALTIYGLVVALSLLFANPFTS

Protein Names:Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpH Ordered Locus Names:Heak452_Cp077

Expression Region:1-82

Sequence Info:full length protein

View full details