Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein(S)

Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein(S)

SKU:CSB-CF333496HEB

Regular price ¥280,700 JPY
Regular price Sale price ¥280,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Hepatitis B virus genotype C subtype adr (isolate China/NC-1/1988) (HBV-C)

Uniprot NO.:P30019

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGP CKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Protein Names:Recommended name: Small envelope protein Alternative name(s): S glycoprotein S-HBsAg Short name= SHB Small S protein Small surface protein

Gene Names:Name:S

Expression Region:1-226

Sequence Info:full length protein

View full details