Gene Bio Systems
Recombinant Heme exporter protein C(helC)
Recombinant Heme exporter protein C(helC)
SKU:CSB-CF346736FFT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas fluorescens
Uniprot NO.:P52222
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:IKYSVEWWNTLHQGATFTLTEKPAMPVEMWAPLLLMVLGFYCFFGAVLLLRMRLEVLKRE ARTSWVKAEVQTSLGARG
Protein Names:Recommended name: Heme exporter protein C Alternative name(s): Cytochrome c-type biogenesis protein HelC
Gene Names:Name:helC
Expression Region:1-78
Sequence Info:full length protein
