Skip to product information
1 of 1

Gene Bio Systems

Recombinant Heliobacterium modesticaldum UPF0059 membrane protein Helmi_08630 (Helmi_08630)

Recombinant Heliobacterium modesticaldum UPF0059 membrane protein Helmi_08630 (Helmi_08630)

SKU:CSB-CF534961HVD

Regular price ¥280,000 JPY
Regular price Sale price ¥280,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)

Uniprot NO.:B0TI68

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTYWTLGVLAVGLGADAFSMALGIGMEGVRRRDAFMLGLVVALFHIFMPWFGILAGSALG LVVGRLASFIGAAVLFFLGGRMIYHAWKEKREGPAFPVSVPRRRGNGSGGGAIVGAGAIV GGRLFAPTRWELVVIGAAVSMDALSVGFSLGTVGAQLLPTVLTFGVVAGIMTVAGCRIGQ QVSRMLGATAQLAGGLILLGIGIKLLLGSASPG

Protein Names:Recommended name: UPF0059 membrane protein Helmi_08630

Gene Names:Ordered Locus Names:Helmi_08630 ORF Names:HM1_1086

Expression Region:1-213

Sequence Info:full length protein

View full details