Gene Bio Systems
Recombinant Helicobacter pylori UPF0114 protein HPG27_173 (HPG27_173)
Recombinant Helicobacter pylori UPF0114 protein HPG27_173 (HPG27_173)
SKU:CSB-CF471554HUX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Helicobacter pylori (strain G27)
Uniprot NO.:B5Z9W0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLDTISETDLVLSALG LVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIF LLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFSQNKGH
Protein Names:Recommended name: UPF0114 protein HPG27_173
Gene Names:Ordered Locus Names:HPG27_173
Expression Region:1-177
Sequence Info:full length protein
