Skip to product information
1 of 1

Gene Bio Systems

Recombinant Helicobacter pylori Uncharacterized protein HP_1330 (HP_1330)

Recombinant Helicobacter pylori Uncharacterized protein HP_1330 (HP_1330)

SKU:CSB-CF522895HUV

Regular price ¥225,500 JPY
Regular price Sale price ¥225,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Uniprot NO.:O25888

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLMHSILIILVIILTTYFTRIWPFMVFNAKNPPNDFVRYLGRALSCSVIGMLVIYCFKDI HILKPPYGINEITAFLSVILLHRIFKVFVLSITLPTILYMVLVQSHALEKAFFNP

Protein Names:Recommended name: Uncharacterized protein HP_1330

Gene Names:Ordered Locus Names:HP_1330

Expression Region:1-115

Sequence Info:full length protein

View full details