Skip to product information
1 of 1

Gene Bio Systems

Recombinant Helianthus annuus Cytochrome c oxidase subunit 5C-2(COX5C2)

Recombinant Helianthus annuus Cytochrome c oxidase subunit 5C-2(COX5C2)

SKU:CSB-CF819807HUO

Regular price ¥217,300 JPY
Regular price Sale price ¥217,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Helianthus annuus (Common sunflower)

Uniprot NO.:Q8VY39

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGGGRVAHPVLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVV VDEE

Protein Names:Recommended name: Cytochrome c oxidase subunit 5C-2 Alternative name(s): Cytochrome c oxidase polypeptide Vc-2

Gene Names:Name:COX5C2

Expression Region:1-64

Sequence Info:full length protein

View full details