Skip to product information
1 of 1

Gene Bio Systems

Recombinant Halomonas halodenitrificans Nitric oxide reductase subunit C(norC)

Recombinant Halomonas halodenitrificans Nitric oxide reductase subunit C(norC)

SKU:CSB-CF526216HTY

Regular price ¥266,800 JPY
Regular price Sale price ¥266,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Halomonas halodenitrificans (Paracoccus halodenitrificans)

Uniprot NO.:O50651

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ADGLTKSAARNIFYGGSLFFFLLFAALTAHSHWYMVNKSTDNEGLTESVVAGKHIWEKNM CINCHSIMGEGAYFAPELSNVWERYGGHQNPEAARAGLAAWIRAQPLGTQGRRQMPAYDF TDEEMSSLIDFLEWTDGIDDQDWPPHPAG

Protein Names:Recommended name: Nitric oxide reductase subunit C Alternative name(s): NOR small subunit Nitric oxide reductase cytochrome c subunit

Gene Names:Name:norC

Expression Region:2-150

Sequence Info:full length protein

View full details