Skip to product information
1 of 1

Gene Bio Systems

Recombinant Halobacterium salinarum UPF0290 protein VNG_2119C(VNG_2119C)

Recombinant Halobacterium salinarum UPF0290 protein VNG_2119C(VNG_2119C)

SKU:CSB-CF875812HTM

Regular price ¥273,000 JPY
Regular price Sale price ¥273,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Uniprot NO.:Q9HNG1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLVGTVVVAVWAMLPAYVPNNAAVLAGGGRPIDGGRSLGGRRLLGDGKTWRGTAVGTAA GVALAVALNALRPAAADALGVVLPAFPPAAMGTLAFGAMVGDIAASFLKRRTGRQRGAAF PVVDQLDFVVVALALTALAVPAWVGDTFGLPVLVTVAVLTPALHLLTNGIAYALGVKDEP W

Protein Names:Recommended name: UPF0290 protein VNG_2119C

Gene Names:Ordered Locus Names:VNG_2119C

Expression Region:1-181

Sequence Info:full length protein

View full details