Skip to product information
1 of 1

Gene Bio Systems

Recombinant Halobacterium salinarum Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)

Recombinant Halobacterium salinarum Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)

SKU:CSB-CF888128HTM

Regular price ¥263,000 JPY
Regular price Sale price ¥263,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Uniprot NO.:Q9HQ63

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSESYDRGLVADFGRWTEFSAGMWAWVFHKFTGWVLVGYLFTHISVLSTSLQGAQVYNST LSGLESLAIVRLLEVGLLAVAVFHILNGIRLLFVDLGVGLEAQDKSFYASLVLTGVIVVA SVPTFLTGAF

Protein Names:Recommended name: Succinate dehydrogenase hydrophobic membrane anchor subunit

Gene Names:Name:sdhD Synonyms:sdhC Ordered Locus Names:VNG_1310G

Expression Region:1-130

Sequence Info:full length protein

View full details