Skip to product information
1 of 1

Gene Bio Systems

Recombinant Halobacterium salinarum Sensory rhodopsin-1(sop1)

Recombinant Halobacterium salinarum Sensory rhodopsin-1(sop1)

SKU:CSB-CF340747HTM

Regular price ¥283,500 JPY
Regular price Sale price ¥283,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Uniprot NO.:P25964

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDAVATAYLGGAVALIVGVAFVWLLYRSLDGSPHQSALAPLAIIPVFAGLSYVGMAYDIG TVIVNGNQIVGLRYIDWLVTTPILVGYVGYAAGASRRSIIGVMVADALMIAVGAGAVVTD GTLKWALFGVSSIFHLSLFAYLYVIFPRVVPDVPEQIGLFNLLKNHIGLLWLAYPLVWLF GPAGIGEATAAGVALTYVFLDVLAKVPYVYFFYARRRVFMHSESPPAPEQATVEATAAD

Protein Names:Recommended name: Sensory rhodopsin-1 Alternative name(s): Sensory rhodopsin I Short name= SR-I

Gene Names:Name:sop1 Synonyms:sopI Ordered Locus Names:VNG_1660G

Expression Region:1-239

Sequence Info:full length protein

View full details