Skip to product information
1 of 1

Gene Bio Systems

Recombinant Halobacterium salinarum Putative cobalt transport protein CbiM(cbiM)

Recombinant Halobacterium salinarum Putative cobalt transport protein CbiM(cbiM)

SKU:CSB-CF534750HTL

Regular price ¥272,500 JPY
Regular price Sale price ¥272,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

Uniprot NO.:B0R611

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHIMEGFLPGIWALVWFVVAIPVISYGALKTARLARNDELNKSHIAVAAAFIFVLSALKI PSVTGSTSHPTGTGIAVVLFGPAVTAFLSAIVLLYQALLLGHGGLTTLGANVVSMGVVGP VAGWVVFRALNPYLDLQKATFAAAVIADWTTYLVTSIQLGVAFPSGPGVAGVVDSIVRFA SVFSITQIPIGIVEGALAAGLIGYIAMSRQSIKTRLGVTA

Protein Names:Recommended name: Putative cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM

Gene Names:Name:cbiM Ordered Locus Names:OE3319R

Expression Region:1-220

Sequence Info:full length protein

View full details